SangerAlignment-class: SangerAlignment

In roblanf/sangeranalyseR: sangeranalyseR: a suite of functions for the analysis of Sanger sequence data in R

SangerAlignment

Description

An S4 class containing SangerContigs lists and contigs alignment results which corresponds to a final alignment in Sanger sequencing.

Slots

objectResults

This is the object that stores all information of the creation result.

inputSource

The input source of the raw file. It must be "ABIF" or "FASTA". The default value is "ABIF".

processMethod

The method to create a contig from reads. The value is "REGEX" or "CSV". The default value is "REGEX".

ABIF_Directory

If inputSource is "ABIF", then this value is the path of a parent directory storing all reads in ABIF format you want to analyse. If inputSource is "FASTA", then this value has to be NULL by default.

FASTA_File

If inputSource is "FASTA", then this value has to be the path to a valid FASTA file ; if inputSource is "ABIF", then this value has to be NULL by default.

REGEX_SuffixForward

The suffix of the filenames for forward reads in regular expression, i.e. reads that do not need to be reverse-complemented. For forward reads, it should be "_F.ab1".

REGEX_SuffixReverse

The suffix of the filenames for reverse reads in regular expression, i.e. reads that need to be reverse-complemented. For revcerse reads, it should be "_R.ab1".

CSV_NamesConversion

The file path to the CSV file that provides read names, directions, and their contig groups. If processMethod is "CSV", then this value has to be the path to a valid CSV file; if processMethod is "REGEX", then this value has to be NULL by default.

geneticCode

Named character vector in the same format as GENETIC_CODE (the default), which represents the standard genetic code. This is the code with which the function will attempt to translate your DNA sequences. You can get an appropriate vector with the getGeneticCode() function. The default is the standard code.

refAminoAcidSeq

An amino acid reference sequence supplied as a string or an AAString object. If your sequences are protein-coding DNA seuqences, and you want to have frameshifts automatically detected and corrected, supply a reference amino acid sequence via this argument. If this argument is supplied, the sequences are then kept in frame for the alignment step. Fwd sequences are assumed to come from the sense (i.e. coding, or "+") strand. The default value is "".

contigList

A list storing all SangerContigs S4 instances.

contigsConsensus

The consensus read of all SangerContig S4 instances in DNAString object.

contigsAlignment

The alignment of all SangerContig S4 instances with the called consensus sequence in DNAStringSet object. Users can use BrowseSeqs() to view the alignment.

contigsTree

A phylo instance returned by bionj function in ape package. It can be used to draw the tree.

Author(s)

Kuan-Hao Chao

Examples

## Simple example
rawDataDir <- system.file("extdata", package = "sangeranalyseR")
parentDir <- file.path(rawDataDir, 'Allolobophora_chlorotica', 'ACHLO')
my_aligned_contigs <- new("SangerAlignment",
                          ABIF_Directory     = parentDir,
                          REGEX_SuffixForward = "_[0-9]*_F.ab1$",
                          REGEX_SuffixReverse = "_[0-9]*_R.ab1$")
                          
rawDataDir <- system.file("extdata", package = "sangeranalyseR")
parentDir <- file.path(rawDataDir, 'Allolobophora_chlorotica', 'ACHLO')
CSV_NamesConversion <- file.path(rawDataDir, "ab1", "SangerAlignment", "names_conversion.csv")
sangerAlignment <- new("SangerAlignment",
                       processMethod          = "CSV",
                       ABIF_Directory         = parentDir,
                       CSV_NamesConversion    = CSV_NamesConversion)

## Input From ABIF file format (Regex)
REGEX_SuffixForward <- "_[0-9]*_F.ab1$"
REGEX_SuffixReverse <- "_[0-9]*_R.ab1$"
sangerAlignment <- new("SangerAlignment",
                       printLevel            = "SangerAlignment",
                       inputSource           = "ABIF",
                       processMethod         = "REGEX",
                       FASTA_File            = NULL,
                       CSV_NamesConversion   = NULL,
                       ABIF_Directory        = parentDir,
                       REGEX_SuffixForward   = REGEX_SuffixForward,
                       REGEX_SuffixReverse   = REGEX_SuffixReverse,
                       TrimmingMethod        = "M1",
                       M1TrimmingCutoff      = 0.0001,
                       M2CutoffQualityScore  = NULL,
                       M2SlidingWindowSize   = NULL,
                       baseNumPerRow         = 100,
                       heightPerRow          = 200,
                       signalRatioCutoff     = 0.33,
                       showTrimmed           = TRUE,
                       refAminoAcidSeq = "SRQWLFSTNHKDIGTLYFIFGAWAGMVGTSLSILIRAELGHPGALIGDDQIYNVIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPALSLLLVSSMVENGAGTGWTVYPPLSAGIAHGGASVDLAIFSLHLAGISSILGAVNFITTVINMRSTGISLDRMPLFVWSVVITALLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIISQESGKKETFGSLGMIYAMLAIGLLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAVPTGIKIFSWLATLHGTQLSYSPAILWALGFVFLFTVGGLTGVVLANSSVDIILHDTYYVVAHFHYVLSMGAVFAIMAGFIHWYPLFTGLTLNNKWLKSHFIIMFIGVNLTFFPQHFLGLAGMPRRYSDYPDAYTTWNIVSTIGSTISLLGILFFFFIIWESLVSQRQVIYPIQLNSSIEWYQNTPPAEHSYSELPLLTN",
                       minReadsNum           = 2,
                       minReadLength         = 20,
                       minFractionCall       = 0.5,
                       maxFractionLost       = 0.5,
                       geneticCode           = GENETIC_CODE,
                       acceptStopCodons      = TRUE,
                       readingFrame          = 1,
                       processorsNum         = 2)

## Input From ABIF file format (Csv three column)
rawDataDir <- system.file("extdata", package = "sangeranalyseR")
parentDir <- file.path(rawDataDir, 'Allolobophora_chlorotica', 'ACHLO')
CSV_NamesConversion <- file.path(rawDataDir, "ab1", "SangerAlignment", 
"names_conversion_all.csv")
sangerAlignment <- new("SangerAlignment",
                       inputSource           = "ABIF",
                       processMethod         = "CSV",
                       ABIF_Directory        = parentDir,
                       CSV_NamesConversion   = CSV_NamesConversion,
                       refAminoAcidSeq = "SRQWLFSTNHKDIGTLYFIFGAWAGMVGTSLSILIRAELGHPGALIGDDQIYNVIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPALSLLLVSSMVENGAGTGWTVYPPLSAGIAHGGASVDLAIFSLHLAGISSILGAVNFITTVINMRSTGISLDRMPLFVWSVVITALLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIISQESGKKETFGSLGMIYAMLAIGLLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAVPTGIKIFSWLATLHGTQLSYSPAILWALGFVFLFTVGGLTGVVLANSSVDIILHDTYYVVAHFHYVLSMGAVFAIMAGFIHWYPLFTGLTLNNKWLKSHFIIMFIGVNLTFFPQHFLGLAGMPRRYSDYPDAYTTWNIVSTIGSTISLLGILFFFFIIWESLVSQRQVIYPIQLNSSIEWYQNTPPAEHSYSELPLLTN",
                       TrimmingMethod        = "M1",
                       M1TrimmingCutoff      = 0.0001,
                       M2CutoffQualityScore  = NULL,
                       M2SlidingWindowSize   = NULL,
                       baseNumPerRow         = 100,
                       heightPerRow          = 200,
                       signalRatioCutoff     = 0.33,
                       showTrimmed           = TRUE,
                       processorsNum         = 2)

## Input From FASTA file format (No Csv - Regex)
rawDataDir <- system.file("extdata", package = "sangeranalyseR")
fastaFN <- file.path(rawDataDir, "fasta",
                     "SangerAlignment", "Sanger_all_reads.fa")
REGEX_SuffixForwardFa <- "_[0-9]*_F$"
REGEX_SuffixReverseFa <- "_[0-9]*_R$"
sangerAlignmentFa <- new("SangerAlignment",
                         inputSource           = "FASTA",
                         processMethod         = "REGEX",
                         FASTA_File            = fastaFN,
                         REGEX_SuffixForward   = REGEX_SuffixForwardFa,
                         REGEX_SuffixReverse   = REGEX_SuffixReverseFa,
                         refAminoAcidSeq = "SRQWLFSTNHKDIGTLYFIFGAWAGMVGTSLSILIRAELGHPGALIGDDQIYNVIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPALSLLLVSSMVENGAGTGWTVYPPLSAGIAHGGASVDLAIFSLHLAGISSILGAVNFITTVINMRSTGISLDRMPLFVWSVVITALLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIISQESGKKETFGSLGMIYAMLAIGLLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAVPTGIKIFSWLATLHGTQLSYSPAILWALGFVFLFTVGGLTGVVLANSSVDIILHDTYYVVAHFHYVLSMGAVFAIMAGFIHWYPLFTGLTLNNKWLKSHFIIMFIGVNLTFFPQHFLGLAGMPRRYSDYPDAYTTWNIVSTIGSTISLLGILFFFFIIWESLVSQRQVIYPIQLNSSIEWYQNTPPAEHSYSELPLLTN",
                         processorsNum         = 2)

## Input From FASTA file format (Csv three column method)
rawDataDir <- system.file("extdata", package = "sangeranalyseR")
fastaFN <- file.path(rawDataDir, "fasta",
                     "SangerAlignment", "Sanger_all_reads.fa")
CSV_NamesConversion <- file.path(rawDataDir, "fasta",
                                "SangerAlignment", "names_conversion.csv")
sangerAlignmentFa <- new("SangerAlignment",
                         inputSource           = "FASTA",
                         processMethod         = "CSV",
                         FASTA_File            = fastaFN,
                         CSV_NamesConversion   = CSV_NamesConversion,
                         refAminoAcidSeq = "SRQWLFSTNHKDIGTLYFIFGAWAGMVGTSLSILIRAELGHPGALIGDDQIYNVIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPALSLLLVSSMVENGAGTGWTVYPPLSAGIAHGGASVDLAIFSLHLAGISSILGAVNFITTVINMRSTGISLDRMPLFVWSVVITALLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIISQESGKKETFGSLGMIYAMLAIGLLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAVPTGIKIFSWLATLHGTQLSYSPAILWALGFVFLFTVGGLTGVVLANSSVDIILHDTYYVVAHFHYVLSMGAVFAIMAGFIHWYPLFTGLTLNNKWLKSHFIIMFIGVNLTFFPQHFLGLAGMPRRYSDYPDAYTTWNIVSTIGSTISLLGILFFFFIIWESLVSQRQVIYPIQLNSSIEWYQNTPPAEHSYSELPLLTN",
                         processorsNum         = 2)

roblanf/sangeranalyseR documentation built on April 15, 2024, 12:44 a.m.