Description Usage Arguments Details Value Author(s) See Also Examples
View source: R/704-calcProtSeqSim.R
Protein Sequence Alignment for Two Protein Sequences
1 | calcTwoProtSeqSim(seq1, seq2, type = "local", submat = "BLOSUM62")
|
seq1 |
A character string, containing one protein sequence. |
seq2 |
A character string, containing another protein sequence. |
type |
Type of alignment, default is |
submat |
Substitution matrix, default is |
This function implements the sequence alignment between two protein sequences.
An Biostrings object containing the scores and other alignment information.
Nan Xiao <https://nanx.me>
See calcParProtSeqSim
for paralleled pairwise
protein similarity calculation based on sequence alignment.
See calcTwoProtGOSim
for calculating the
GO semantic similarity between two groups of GO terms or two Entrez gene IDs.
1 2 3 4 5 6 | s1 = readFASTA(system.file('protseq/P00750.fasta', package = 'Rcpi'))[[1]]
s2 = readFASTA(system.file('protseq/P10323.fasta', package = 'Rcpi'))[[1]]
seqalign = calcTwoProtSeqSim(s1, s2)
seqalign
slot(seqalign, "score")
|
OpenJDK 64-Bit Server VM warning: Can't detect primordial thread stack location - find_vma failed
Local PairwiseAlignmentsSingleSubject (1 of 1)
pattern: [299] CGLRQYSQPQ--FRIKGGLFADIASHPWQAA...TLVGIISWGLGCGQKDVPGVYTKVTNYLDWI
subject: [29] CGLRFRQNPQGGVRIVGGKAAQHGAWPWMVS...VVVGITSWGVGCARAKRPGIYTATWPYLNWI
score: 277
[1] 277
Add the following code to your website.
For more information on customizing the embed code, read Embedding Snippets.